PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn015051
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family ZF-HD
Protein Properties Length: 262aa    MW: 29416.8 Da    PI: 8.1771
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn015051genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.98.7e-3268123359
  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                  ++r++eClkNhAas+Gg+++DGCgEfmps g++gt++alkCaAC+CHRnFHRre+++
   Achn015051  68 GTRFRECLKNHAASVGGNVLDGCGEFMPS-GDDGTMEALKCAACNCHRNFHRREPDH 123
                  579*************************9.999********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257745.0E-2169122IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.9E-2969121IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015666.9E-3070120IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.32971120IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466894.63E-18188251IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.4E-30190253IPR009057Homeodomain-like
TIGRFAMsTIGR015655.1E-28191248IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MEMKGQQGSL GYNNEPIFRE TSETLDRHHH LLEQNSPTTT RRPNQDQFNG SGGERVAQKS  60
SGSSLISGTR FRECLKNHAA SVGGNVLDGC GEFMPSGDDG TMEALKCAAC NCHRNFHRRE  120
PDHGSEFALH LPPPLPSLRQ HQRLWTPLVS PVKMAFGGTD SSSEDFHFNT VHSNEAAVRG  180
APPPPPFVLS KKRFRTKFTQ DQKEKMLEYA EKVGWRIPRE DDAEVQRFCA EVGVKRRVLK  240
VWMHNNKNSS AKKQPHEEEE S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A3e-251902491675ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083674.11e-82PREDICTED: zinc-finger homeodomain protein 5
SwissprotQ9M9S02e-59ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLA0A103YCG22e-82A0A103YCG2_CYNCS; Homeodomain-like protein
STRINGSolyc04g080490.2.12e-75(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.21e-60homeobox protein 31